SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020531 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020531
Domain Number 1 Region: 870-1169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000135
Further Details:      
 
Domain Number 2 Region: 214-358
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-212
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-24
Family Second domain of FERM 0.00056
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-18
Family First domain of FERM 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020531   Gene: ENSNLEG00000016898   Transcript: ENSNLET00000021552
Sequence length 1173
Comment pep:novel supercontig:Nleu1.0:GL397280.1:25672215:25771295:-1 gene:ENSNLEG00000016898 transcript:ENSNLET00000021552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTIYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILERSIPCTLEQAIRLAALFKADFGDFDQYESQDFLQKFALFPVGWLQDEKVL
EEATQKVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGI
FVKHKNGRHPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYIWRLCVARH
KFYRLNQCNLQTQTITVNPIRRRSSSRTPLPKPQPYVMPPPPQLHYNGHYTEPYASSQDN
LFVPNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPSI
TGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGLVHAERQSHSLRNLNIGSSY
AYSRPAALVYSQPEIREHAQLPSPPAAHCPFSLSYSFHSPSPYPYPAERRPVVGAVSVPE
LTNAQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRVHH
SVQTFQEDSLPVAHSLQEVSEPLTAVRHAQLHKRNSIEVAGLSHGLEGLRLKERTLSASA
AEVAPRALSAGSQPSVFTERTKREGPEEAEGLRYGHKKSLSDATMLIHSSEEEDDEDFEE
ESGARAPPARARESRPGLAQDPPGCPRALLAGPLHILEPKAHFPDAEKRLMDSSPVRTTA
EAQRPWRDGLLMPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPLGGMKK
TRVDAKKIGPLKLAALNGLSLSRVPLPDEGKEVATRATNDERCKILEQRLEQGMVFTEYE
RILKKRLIDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSVS
GIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTV
TYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYL
EEIQSVRRHTNSTSDPQSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRVLD
MLRQQRMMLVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences ENSNLEP00000020531 ENSNLEP00000020531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]