SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020733 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020733
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-47
Family C-type lysozyme 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020733   Gene: ENSNLEG00000017070   Transcript: ENSNLET00000021770
Sequence length 194
Comment pep:novel supercontig:Nleu1.0:GL397323.1:13815943:13834742:-1 gene:ENSNLEG00000017070 transcript:ENSNLET00000021770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAHLSCQSPTKWSSASSTDSTEKSASGAGTRNLPFQFCLRQALKMKVAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQRVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETKGMNYWQGWKKHCE
GRDLSDWKKGCEVS
Download sequence
Identical sequences G1S5A5
ENSNLEP00000020733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]