SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020803 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020803
Domain Number 1 Region: 1060-1273
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-53
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 1739-1979
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000121
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1265-1361
Classification Level Classification E-value
Superfamily PH domain-like 0.000000123
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020803   Gene: ENSNLEG00000017127   Transcript: ENSNLET00000021844
Sequence length 2064
Comment pep:novel supercontig:Nleu1.0:GL397264.1:17025818:17090862:-1 gene:ENSNLEG00000017127 transcript:ENSNLET00000021844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGAPRPQLYRSVSFKLLERWSGGPGPREEDTDTPGLRRRASCRPTTAARGQPSRRVSK
LASGPPAAPAQPRPLRSLSPSVRQLSRRFDAPRLDYGSAGARDGGVFPAAAEEAAEGPAR
GAWPSVTEMRKLFGGPGSRRPSADSESPGTPSPDGAAWEPPARESRQPPTPPPRTCFPLA
GLRSARPLTGPGTEGRLRRPQQQQERAQRPADGLHSWHIFSQPQAGARASCSSSSSIASS
YPVSRSRAASSSEEEEEGPPQPPGAQSPAYHGGHSSGSDDDLDGEGSHRWGGRPRLRPGS
SLLDQDCRPDSDGLNLSSMDSAGGAGSPEPPTSPRAPREEGLREWGSGSPPCVPGPQEGL
RPMSDSVGGAFRVAKVSFPSYLASPAGSRGSSRYSSTETLKDDDLWSSRGSGGGGVYRSP
SFGAGEGLLRSQARTRAKGPGGTSRALRDGGFEPEKSPQRKSLSNPDIASETLTLLSFLR
SDLSELRVRKPGGSPGDRGSSPLDGRDSSSAGGPVGQLEPIPIPAPASPGTRPTLKDLTA
TLRRAKSFTCSEKPMARRLPRTSALKPSSSELLLTGPGAEEDPLPLIVQDQYVQEARQVF
EKIQRMGAQQDDGSDAHPGSPDWAGDVTRGQRSQEELSGPESSLTDEGIGADPEPPVAAF
CGLGTTGMWRPLSSSSAQTNHHGPGTEDSLGGWALVSPETPPTPGALRRRRKVPPSGSGG
SELSSGEAGEAYRSLSDPIPQRHRAATSEEPTGFSMDSNLLGSLSPKTGLPATSAMDEGL
TSGHSDWSVGSEESKGYQEVIQNIVQGPGTLGRVVDDRVAGKAPKKKSLSDPSRRGELAG
PGFEGPGGEPIREVEPVLPPSSSEPILVEQRAEPEEPGAARSRAQSERALPEALPPPATA
HRNFHLDPKLADILSPRLIRRGSKKRPARSSHQELRRDEGSQDQTGGLSRARPSSKHVRH
ASVPATFMPIVVPEPPTSVGPPVAVPEPIGFPTRAHPTLQAPSLEDVTKQYMLNLHSGEV
PAPVPVDMPCLPLAAPPSTEAKPPEAARTPDEPPPASKCCSKPQVDMRKHVAMTLLDTEQ
SYVESLRTLMQGYMQPLKQPENSVLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCMQTWH
AQQKVGALLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEK
QALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAE
EAERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAISGKKDRSLFLFTDLIVCTT
LKRKSGSLRRSSMSLYTAASVIDTASKYKMLWKLPLEDTDIIKGASQATNRENIQKAISR
LDEDLTTLGQMSKLSESLGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELC
ATRPEGTDSYIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQF
SCAAPTLNSCPEPSPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGL
QPRCHREPPPSLRSPPETAPEPAGPELDVEAAADEEAATLAEPGQQPCLHISIAGSGLEI
TPGLAEGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAET
TSSEEEQEPGFLPLSGSFGPGGPCGTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQS
SVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQRE
AGHFWDPQNFKSVTLGTQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQDS
SRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKA
ACLRITALLVCEELLWVGTSAGVVLTMPTSPGTVSCPRAPLSPTGLGQGHTGHVRFLAAV
QLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPRHRGPVPARPKMLVISGGDGYEDFRLS
SGGSSSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences G1S5L5
XP_003254791.1.23891 ENSNLEP00000020803 ENSNLEP00000020803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]