SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021026 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021026
Domain Number 1 Region: 1876-1950
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-38
Family Classic zinc finger, C2H2 0.0000228
Further Details:      
 
Domain Number 2 Region: 538-608
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000126
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 
Domain Number 3 Region: 2099-2151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000101
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 2053-2109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000448
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number 5 Region: 2362-2410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000187
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021026
Domain Number - Region: 2254-2301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000432
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 2466-2498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000976
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1470-1495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00319
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 2145-2169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00443
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00596
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 1116-1139,1262-1287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0178
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 439-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0183
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 885-916
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0238
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 843-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0358
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 600-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0434
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 1662-1687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0809
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 162-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0839
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021026   Gene: ENSNLEG00000017310   Transcript: ENSNLET00000022082
Sequence length 2568
Comment pep:novel supercontig:Nleu1.0:GL397279.1:14621434:14772134:1 gene:ENSNLEG00000017310 transcript:ENSNLET00000022082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNVNEPRCGSMNASNQTEVEFS
SIKDEFAIAEDLSGQNATALGTGGYYGHSPGYYGQHIAANPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEGSSSGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETTAPPPAPAPMPDPVVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNLPDVPNKSAPSPTSNS
TYLTMNAASREIPNTTVSNFRGSMGNSIMRPNSSSASKFSPMSYPQMKPKSPHNSGLVNL
VERSRYGMTDMTNSSADLETNSMLNDSSSDEELNEIDSENGLSAMDHQTSGLSAEQLMGS
DGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTC
KSSLKLGAHKQCHTGTTSDWDAVNSQSESISSSLNEGVVSYESSSINGRKSGVMLDPLQQ
QQPPQPPPPPPPPPPSQPQPLQQPQPPQLQPPHQVPPQPQTQPPPTQQPQPPTQAAPLHP
YKCTMCNYSTTTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQ
TSILGLSSKNNFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQSKISQTKQQEDAVIN
VEDDEEEEEDNEVEIEVELDREEEPTEPIIEVPTSFSAQQIWARDTSEPQKEPNFRNITH
DYNATNGAEIELTLSEDEEDYYGSSTNLKDHQVSNTALLNTQNPIYGTEHNNENTDFGDS
GRLYYCKHCDFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFE
DLQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIF
SSYVVEQQEGLNTESQTLREILNSAPKNMATSTPVARGGGLPATFNKNTPSKTFTPECEN
QKDPLVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSAL
SQLSFEVGAPMSPKMSNMGSPPPPQPPPPDLSTELYYCKHCSYSNRSVVGVLVHYQKRHP
EIKVTAKYIRQAPPTAAMMRGVEGPQGSPRPPAPIQQLNRSSSERDGPPVENEMFFCQHC
DYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKKPASCVLVSPSNLERD
KTKLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCI
YSHTEPNGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMPAEAKTYRCRDCVFEA
VSIWDITNHYQAFHPWAMNGDESVLLDIIKDKDAVEKPILSSEELAGPVNCENSIPTPLP
EPEAECPEDARLSPEKSLQLASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKV
KAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPSVKVTAEDFVHDVEQSADI
SQNDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSQSPPKLPVP
LEPEMTTDVSPSQVSITEEEVGEEPVSTSHFSTSHLVSHTVFRCQLCKYFCSTRKGIARH
YRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISD
KPNKVIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQ
HASKLGGYFTAVYADEHEKPTLMEEEERGSFEKAEVEGEAQEIEWLPFRCIKCFKLSFST
AELLCMHYTDHHSRDLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEF
QKRAKRQERRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHP
TLRAICNHLRKHVQYGNVPAVSAAVKEADDPAHLFLDELEAAKDASGALVGRVDGEHCLL
DGMLEDETRPGGYHCSQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRH
NLDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQL
KEHSLKVHGKALTLPRPRIVSLLSSHSHHSSQKATPAEEVEDSNDSSYSEPPDVQQQLNH
YQSAALARNNSRVSPVPLSGAAAGNEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKK
LFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE
ERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETK
HTEELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEEEMNSKPEDREL
MRFSDHGAVINTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQMSREEIHPKEIME
NSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAKKE
Download sequence
Identical sequences ENSNLEP00000021026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]