SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021072 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021072
Domain Number 1 Region: 248-303
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 82-140
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 309-364
Classification Level Classification E-value
Superfamily SH3-domain 0.0000381
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021072   Gene: ENSNLEG00000017363   Transcript: ENSNLET00000022142
Sequence length 364
Comment pep:novel supercontig:Nleu1.0:GL397261.1:55547223:55556057:1 gene:ENSNLEG00000017363 transcript:ENSNLET00000022142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKEVLESPKPSFPAETRQSGLQRLKQLLRKGSTGTKEMELPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEEPPQEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRC
KNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFET
LRTGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGKPQDGNPEGDKKAEKKTLDDK
HKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNF
IIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDF
LEEI
Download sequence
Identical sequences G1S6D3
XP_003252823.1.23891 ENSNLEP00000021072 ENSNLEP00000021072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]