SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021154 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021154
Domain Number 1 Region: 190-322
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 88-192
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 7-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-24
Family First domain of FERM 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021154   Gene: ENSNLEG00000017431   Transcript: ENSNLET00000022229
Sequence length 820
Comment pep:novel supercontig:Nleu1.0:GL397279.1:16994768:17142500:-1 gene:ENSNLEG00000017431 transcript:ENSNLET00000022229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXKATLYRVFMLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWL
DHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYET
AVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAEL
SYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKK
SKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDF
IRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKT
NPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSSSDRLPFGIEENGGTPFLTAA
SGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSSKSLTKLSPGTPALFSEAAAH
LKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENA
SRVNIQGGKEESTFVNINKKSSLQDPSVRSPIPIRVETAQPPVEKPEIKPPRVRKLTRQY
SFDEDDLPPDLAEAVGVTTATTTNTTTAATQVSVPLPSPKVQNVSSPHKSEGKGPLSPGA
KSPSDRGGAFTLEPGDLLMDFTEATPLAEPASNPHCAHSRCSPPLSLPMKEETTGVCMYP
PIKTRLIKTFPVDTMNPFPDAFTTGPQFTADFRDSKLQCCPGPTSPLIPAATLRPLTETV
STVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences ENSNLEP00000021154 ENSNLEP00000021154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]