SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021343 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021343
Domain Number 1 Region: 376-614,647-714
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-53
Family Diacylglycerol kinase-like 0.024
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily EF-hand 3.14e-47
Family EF-hand modules in multidomain proteins 0.00000237
Further Details:      
 
Domain Number 3 Region: 186-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Domain Number 4 Region: 99-183
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000581
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 5 Region: 256-324
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000882
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021343   Gene: ENSNLEG00000017579   Transcript: ENSNLET00000022426
Sequence length 735
Comment pep:novel supercontig:Nleu1.0:GL397261.1:56865709:56889293:-1 gene:ENSNLEG00000017579 transcript:ENSNLET00000022426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPSDFARLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LELDNVPRHLSLALFQSFETGHCLNETNVAKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPIYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGSDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKRLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
Download sequence
Identical sequences G1S754
ENSNLEP00000021343 ENSNLEP00000021343 XP_003252885.1.23891 XP_003252886.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]