SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021636 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021636
Domain Number 1 Region: 358-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000907
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021636
Domain Number - Region: 16-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.0298
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021636   Gene: ENSNLEG00000017810   Transcript: ENSNLET00000022728
Sequence length 632
Comment pep:novel supercontig:Nleu1.0:GL397261.1:62526566:62562708:1 gene:ENSNLEG00000017810 transcript:ENSNLET00000022728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTMMLNIRNLFEQLLRRAEILSEGNELQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKR
EKRRSSSRQFVDGPPGPVKKTRSIGSTVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNKAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
LRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWS
QFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Download sequence
Identical sequences G1S7Z7
ENSNLEP00000021636 XP_003252214.1.23891 XP_003252215.1.23891 XP_012364018.1.23891 ENSNLEP00000021636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]