SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021789 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021789
Domain Number 1 Region: 430-736
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-54
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 296-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 235-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000503
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021789   Gene: ENSNLEG00000017937   Transcript: ENSNLET00000022889
Sequence length 736
Comment pep:novel supercontig:Nleu1.0:GL397264.1:50116251:50217028:-1 gene:ENSNLEG00000017937 transcript:ENSNLET00000022889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGFVIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENREYISVGVKAFFYFLLVLEERNCSDPG
GPVNGYQRITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIK
ACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPMGYQ
HLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENITAPKTQGLRWPW
QAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVL
GKFYRDDDRDEKTIQSLRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAAS
RDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSVT
DNMFCASWDPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLSTA
FTKVLPFKDWIERNMK
Download sequence
Identical sequences ENSNLEP00000021789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]