SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021862 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021862
Domain Number 1 Region: 168-450,477-558
Classification Level Classification E-value
Superfamily ARM repeat 4.53e-39
Family HspBP1 domain 0.074
Further Details:      
 
Domain Number 2 Region: 8-132
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000412
Family 28-residue LRR 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021862   Gene: ENSNLEG00000017994   Transcript: ENSNLET00000022965
Sequence length 577
Comment pep:novel supercontig:Nleu1.0:GL397296.1:581683:637153:-1 gene:ENSNLEG00000017994 transcript:ENSNLET00000022965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XITNVLFYNEDLAEVASLPRLESLDISNTSITDITALLACKDRLKSLTMHHLKCLKMTTT
QILDVVRELKHLNHLDISDDKQFTSDIALRLLEQKDILPNLVSLDVSGRKHVTDKAVEAF
IQQRPSMQFVGLLATDAGYSEFLTGEGHLKVSGEANETQIAEALKRYSERAFFVREALFH
LFSLTHVMEKTKPEILKLVVTGMRNHPMNLPVQLAASACVFNLTKQDLAAGMPVRLLADV
THLLLKAMEHFPNHQQLQKNCLLSLCSDRILQDVPFNRFEAAKLVMQWLCNHEDQNMQRM
AVAIISILAAKLSTEQTAQLGTELFIVRQLLQIVKQKTNQNSVDTTLKFTLSALWNLTDE
SPTTCRHFIENQGLELFMRVLESFPTESSIQQKVLGLLNNIAEVQELHSELMWKDFIDHI
SSLLHSVEVEVSYFAAGIIAHLISRGEQAWTLSRSQRNSLLDDLHSAILKWPTPECEMVA
YRSFNPFFPLLGCFTTPGVQLWAVWAMQHVCSKNPSRYCSMLIEEGGLQHLYNIKDHEHT
DPHVQQIAVAILDSLEKHIVRHGRPPPCKKQPQARLN
Download sequence
Identical sequences ENSNLEP00000021862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]