SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022036 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022036
Domain Number 1 Region: 273-424
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000527
Further Details:      
 
Domain Number 2 Region: 427-584
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000556
Further Details:      
 
Domain Number 3 Region: 644-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-36
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 145-262
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00000111
Further Details:      
 
Domain Number 5 Region: 34-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-30
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022036   Gene: ENSNLEG00000018137   Transcript: ENSNLET00000023151
Sequence length 922
Comment pep:novel supercontig:Nleu1.0:GL397385.1:2382172:2544795:-1 gene:ENSNLEG00000018137 transcript:ENSNLET00000023151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLFCAALALALAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSTFLFI
KFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPK
MSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSG
ILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQITASSQYSTNW
SAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKID
VSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEV
YGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYV
NEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFE
GNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVD
ECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVMDSTIQSEFPTYGFNCEFGWGSHKTFC
HWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHC
MTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIF
EGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGDK
NISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNF
ELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences ENSNLEP00000022036 ENSNLEP00000022036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]