SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022056 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022056
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.21e-74
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022056   Gene: ENSNLEG00000018147   Transcript: ENSNLET00000023172
Sequence length 164
Comment pep:novel supercontig:Nleu1.0:GL397264.1:18814034:18814525:-1 gene:ENSNLEG00000018147 transcript:ENSNLET00000023172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTMFFDIAVNSEPSGHVSFKLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTHHNGTSGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKAKEGMNIVEAIEHFGSRNGKTSKKITTADCGPP
Download sequence
Identical sequences ENSNLEP00000022056 ENSNLEP00000022056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]