SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022542 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022542
Domain Number 1 Region: 127-266
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000262
Family Second domain of FERM 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022542   Gene: ENSNLEG00000018663   Transcript: ENSNLET00000023688
Sequence length 463
Comment pep:novel supercontig:Nleu1.0:GL397348.1:3400315:3401703:-1 gene:ENSNLEG00000018663 transcript:ENSNLET00000023688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRTEGSAGQPGTAERSHRSSMSSVGARAADVLVYLADDTVVPRAVENLPSLSAHELHHT
VREVLQLPDIALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSALDNDVAMDE
SFLQFRRNVFFPKRRELQILDEEVLRLLYEEAKGNVLAARYPCDVEDFEALGALVCRVQL
VPYQPGWPAACDLREKLDSFLPAHLCKRGQGLFAALRGRGARARPGEQGLLNPYRQVQVS
SDGRREATLGTHYRAYLLKCHKMPFYGCAFFHGEVDKPAQGFSHRGGRKPVSVAISLEGV
QVIDSREKHVLLGLRFQELSWDHTSSEEEKPILWLEFDGDSEGTLVNKLLKIYSKQAELM
SSLTEYCFELSQGAEPAGPQDSATGSPSDPRSSPAPAQLPKLRRQGSVVPSRIQHLSTIR
YVEDCKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPSDSLEQG
Download sequence
Identical sequences ENSNLEP00000022542 ENSNLEP00000022542 XP_004092492.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]