SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000549 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000549
Domain Number 1 Region: 214-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 2 Region: 332-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000518
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 372-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000987
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 4 Region: 178-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.046
Further Details:      
 
Domain Number 5 Region: 260-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000444
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000549
Domain Number - Region: 409-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00492
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 296-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.02
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000549   Gene: ENSNLEG00000000459   Transcript: ENSNLET00000000586
Sequence length 594
Comment pep:novel supercontig:Nleu1.0:GL397384.1:3751242:3925934:-1 gene:ENSNLEG00000000459 transcript:ENSNLET00000000586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDKSIIILSLMVFHSSFINGKTCRRQLVEEWHPQPSSYVVNWTLTENICLDFYRDCWFL
GVNTKIDTSGNQAVPQICPLQIQLGDILVISSEPSLQFPEINLMNVSETSFIDCVQNTTT
EDQLLFGCRLKGMHTVNSKWLSVGTHYFITVMASGPSPCPLGLRLNVTVKQQFCQESLSS
EFCSGHGKCLSEAWSKTYNCHCQPPFSGKYCQELDACSFKPCKNNGSCINKRENLDEQAY
ECVCHPPFTGKNCSEIIGQYQPHVCFHGNCSNITSNSFICECDEQFSGPSCEVSKKPCVS
LLCWKRGICPNSSSAYTYECPKGSSSQNGETDVSECSLVPCQNGTDCIKISNDVMCICSP
IFTDLLCKSIQKSCESFPLRNNATCKKCEKDYHCSCLSGFTEKNCEKVIDHCRLLSINCL
NEEWCFNIIGRFKYVCIPGCTRNPCWFLKNVYLIHQHLCYCGVTFRGICQGKCPAQFEYV
WQLGFAGSEGEKCQEVIDVYFFLAANCTEEAIYVNDPEDNNSSCWFPCEGTKEICANGCS
CLSEEDSQEYQYLCFLRWADNMYLENTTDDQENECQHEAICKDEINRPRYLCII
Download sequence
Identical sequences ENSNLEP00000000549 ENSNLEP00000000549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]