SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001090 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001090
Domain Number 1 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000189
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001090   Gene: ENSNLEG00000000924   Transcript: ENSNLET00000001154
Sequence length 205
Comment pep:novel supercontig:Nleu1.0:GL397291.1:4999578:5018824:1 gene:ENSNLEG00000000924 transcript:ENSNLET00000001154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGLQLLLLSCAYSLAPAMPEVKVACSEDVNLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNEMPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGPVTLHKTELV
Download sequence
Identical sequences G1QJJ5
ENSNLEP00000001090 ENSNLEP00000001090 XP_003263582.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]