SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001110 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001110
Domain Number 1 Region: 111-220
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-19
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001110   Gene: ENSNLEG00000000932   Transcript: ENSNLET00000001177
Sequence length 577
Comment pep:novel supercontig:Nleu1.0:GL397352.1:930401:942892:-1 gene:ENSNLEG00000000932 transcript:ENSNLET00000001177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEATVKPREQKAVVRRGTEVDYSRLIAGTLPQSHVTNRRPGWKMPLFLILCLLQGSSF
ALPQKRPHPRWLWEGSLPSRTHLRAMGTLTPSSPLCWREESSFAAPNALKGSRLVSGEPG
GAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNHYTHHRYRDRVALTDFPQRGL
FVVRLSQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPSSTLPTATPAAGELTMRSYGT
ASPVANRWTPGTTQTLGQGTARDTVASTPGTSMTTASAEGRQTPGATRPEAPGTGSWVEG
SVKVPAPIPESPASKSRSMSNTTEGVWEGTISLVTNRVRASKDRREMTTTKADRPREDTE
GVRIALDAAKKVPGTIRPPALVSETLAWEILPQATPVSKQQSLGSIGETTPAAGMWTLGT
PAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATEDRGPQATLSQAPAVGPWRPPGKE
SSVKSTFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLRRRRTSQEAERVTLIQMTHFL
EVNPQADQLPHVERKMLQDDSLPAGASLTVPERNAGP
Download sequence
Identical sequences A0A2I3H3A0
ENSNLEP00000001110 ENSNLEP00000001110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]