SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001290 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001290
Domain Number 1 Region: 249-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 102-163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 65-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000111
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001290   Gene: ENSNLEG00000001074   Transcript: ENSNLET00000001366
Sequence length 452
Comment pep:novel supercontig:Nleu1.0:GL397333.1:2183232:2255981:-1 gene:ENSNLEG00000001074 transcript:ENSNLET00000001366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFDVGRTTHLSSSPCSASNGGESGPVSKRRFLIGEKCGHNTPWCSPIKVKYGDVYCRAP
QGGYYKTALGARCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFK
CVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIA
EPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCK
FRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSG
TEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLR
HITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLQIPLYSFSMVLVDKHGMDKERYVSL
VMPVALFNLIDTFPLRKEEMVLQAEMGQTCNT
Download sequence
Identical sequences ENSNLEP00000001290 ENSNLEP00000001290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]