SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001385 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001385
Domain Number 1 Region: 63-256
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-79
Family Sec7 domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 265-380
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-34
Family Pleckstrin-homology domain (PH domain) 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001385   Gene: ENSNLEG00000001145   Transcript: ENSNLET00000001464
Sequence length 400
Comment pep:novel supercontig:Nleu1.0:GL397594.1:173784:292187:-1 gene:ENSNLEG00000001145 transcript:ENSNLET00000001464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR
ISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences A0A096NQ83 A0A2J8R559 O43739
ENSP00000379967 ENSNLEP00000001385 XP_009240803.1.23681 XP_012351774.1.23891 9598.ENSPTRP00000032293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]