SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001836 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001836
Domain Number 1 Region: 192-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.48e-82
Family Mitochondrial carrier 0.0000317
Further Details:      
 
Domain Number 2 Region: 10-186
Classification Level Classification E-value
Superfamily EF-hand 2.8e-37
Family Penta-EF-hand proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001836   Gene: ENSNLEG00000001473   Transcript: ENSNLET00000001942
Sequence length 477
Comment pep:novel supercontig:Nleu1.0:GL397313.1:3764150:3828428:-1 gene:ENSNLEG00000001473 transcript:ENSNLET00000001942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFVLPTAACQDAEPPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEIYEVPKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEQQAELILQSIDADGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFQRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences A0A2I3GRM5
ENSNLEP00000001836 ENSNLEP00000001836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]