SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002698 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002698
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002698   Gene: ENSNLEG00000002239   Transcript: ENSNLET00000002842
Sequence length 308
Comment pep:novel supercontig:Nleu1.0:GL397324.1:7815935:7818483:-1 gene:ENSNLEG00000002239 transcript:ENSNLET00000002842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTVFGHHPHIAHPLLLPQNGHGNAGSTASPTEPHHQGRLGSAHPEAPALRAPPSGS
LGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRP
WGTEIGAF
Download sequence
Identical sequences A0A2I3GWE0
ENSNLEP00000002698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]