SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002921 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002921
Domain Number 1 Region: 604-806
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000111
Family Mannose 6-phosphate receptor domain 0.0079
Further Details:      
 
Domain Number 2 Region: 221-291,328-349
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000212
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 528-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000392
Family Growth factor receptor domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002921
Domain Number - Region: 25-63
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002921   Gene: ENSNLEG00000002358   Transcript: ENSNLET00000003070
Sequence length 962
Comment pep:novel supercontig:Nleu1.0:GL397313.1:4496085:4534866:1 gene:ENSNLEG00000002358 transcript:ENSNLET00000003070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCNAGEFLDMKDQSCKP
CAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSPAWPWKRDEVSGGY
TEASAVVLSSSDMKTAHLSYKLFLDSGPKLFLCQVQNDQCQPNADDSRWMKTTEKGWEFH
SVELNRGNNGLYWRTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPGTYADKQGSSF
CKLCPANSYSNKGETSCHQCDPDKYSEKGSSSCNMRPACTDKDYFYTHTACDANGETQLM
YKWAKPKICSEDLEGAVKLPASGMKTHCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRC
PAGTEPAVGFEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMI
LTLVVPGFRPPQSVMADTENKEVARITFVFETLCSVNCELYFMVGVNSRTNTPVETWKGS
KGKQSYTYIIEENTTTSFTWAFQRTTFHEASRKYTNDVAKIYSINVTNVMNGVASYCRPC
ALEASDVGSSCTSCPAGYYIDRDSGTCHSCPANTILKAHQPYGVQACVPCGPGTKNNKIH
SLCYNDCTFSRNTPTRTFSYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKM
SVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTT
DMTLDGITSPAELFHPESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLL
LPGTCSDGTCDGCNFHFLWESVAACPLCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGG
ISLPEQRVTICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLK
DCDLPAADSCAIMEGEDVEDDLIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGPDM
DL
Download sequence
Identical sequences ENSNLEP00000002921 ENSNLEP00000002921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]