SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003153 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003153
Domain Number 1 Region: 41-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-69
Family Protein kinases, catalytic subunit 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003153   Gene: ENSNLEG00000002474   Transcript: ENSNLET00000003313
Sequence length 334
Comment pep:novel supercontig:Nleu1.0:GL397387.1:1994192:2127077:1 gene:ENSNLEG00000002474 transcript:ENSNLET00000003313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Download sequence
Identical sequences A0A096NU44 A0A0D9QWI2 A0A2K5P0S9 A0A2K5WZY2 A0A2K5YG13 A0A2K6CS09 A0A2K6LB21 A0A2K6P656 A8K3Y2 G1QQD5 G3QTE4 H2NUJ7 H2QZW5 H9EP89 P52564
ENSP00000468348 NP_001248635.1.72884 NP_002749.2.87134 NP_002749.2.92137 XP_002827807.1.23681 XP_003276131.1.23891 XP_003808992.1.60992 XP_008010157.1.81039 XP_010351423.1.97406 XP_011717941.1.29376 XP_011842312.1.47321 XP_011898103.1.92194 XP_015293315.1.63531 XP_017719217.1.44346 XP_523699.2.37143 ENSNLEP00000003153 gi|14589900|ref|NP_002749.2| ENSPTRP00000039686 ENSPANP00000016565 ENSGGOP00000005958 ENSPPYP00000009634 ENSMMUP00000001409 ENSNLEP00000003153 ENSP00000351997 ENSPTRP00000039686 HR2906 ENSGGOP00000005958 ENSMMUP00000001409 ENSPPYP00000009634 ENSP00000468348 9544.ENSMMUP00000001409 9598.ENSPTRP00000039686 9600.ENSPPYP00000009634 9606.ENSP00000351997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]