SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003215 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003215
Domain Number 1 Region: 1354-1581
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-39
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 400-511
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-29
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 815-927
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 4 Region: 1604-1797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-28
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 5 Region: 504-609
Classification Level Classification E-value
Superfamily Cadherin-like 7e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 290-398
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 185-288
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 915-1030
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 706-810
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 609-710
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 1023-1125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000428
Family Cadherin 0.0077
Further Details:      
 
Domain Number 12 Region: 1281-1371,1568-1617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000424
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1930-1970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000398
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1836-1882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000331
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1801-1835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003215   Gene: ENSNLEG00000002653   Transcript: ENSNLET00000003377
Sequence length 2930
Comment pep:novel supercontig:Nleu1.0:GL397313.1:4585767:4618359:1 gene:ENSNLEG00000002653 transcript:ENSNLET00000003377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPATGAPLPTPPPPPLPPPLLPLLLLLLLLPSPLLGDQVGPCRSLGSRGRGSSGACAP
MGWLCPSSATNLWLYTSRCRDAGTELTGHLVPHHNGLKVWCPKSGAHIPLPPAPEGCPWS
CRLLCIRGHPFPKAKLTLPQEHPCLKAPRLKCQSCKLAQAPRLRAGEGSPEESLGGRRKR
NVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS
LDPTTGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQE
YKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRG
PVDREEVESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKXXXXQVREDVT
PGPVLRVTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRV
RAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADA
GDNARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASA
SVSVTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRN
RFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQS
SHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELD
YEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSV
LQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAV
DKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNA
QIMYQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYILVIQATSAPLVSRATVHVRLL
DRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVL
LNASTGELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLE
DMSPERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPG
GGPPFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAP
FIASSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLC
RDGYTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPA
HSFITFRGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGE
STTTVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALR
FGSVLGNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRQFVGCMRNLQVDSR
HIDMADFIANNGTVPGCPAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMA
NPQHFLGSSLVAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLQEGHVV
LSVEGTGLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRL
HGLHLSNITVGGVPGPAGGVAHGFRGCLQGVRVSDTPEGVNSLDPSRGESINVEQGCSLP
DPCDSNPCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYT
CECPPNYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYR
PPGSPTCLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYD
SCPRAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSITFSELK
GFAERLQRNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATWLLAHESAQRGF
GLSATQDVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRH
TYLSPFTIVTPNIXXXVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPP
VVRPAGPGEAQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPK
RPIINTPVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGW
SARGCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLT
FFFLTLLRILRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTF
SWALLEALHLYRALTEVRDVNTGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLS
IYDTLXXXXXXXXXXXXXMSVFLYILAARASCAAQRQGFEKKGPVSGLQPSFAVLLLLSA
TWLLALLSVNSDTLLFHYLFATCNCIQGPFIFLSYVVLSKEVRKALKLACSRKPSPDPAL
TTKSTLTSSYNCPSPYADGRLYQPYGDSAGSLHSTSRSGKSQPSYIPFLLREESTLNPGQ
GPPGLGDPGSLFLEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEEAA
FPGEQGWDSLLGPGAERLPLHSTPKDGGPGPGKAPWPGDFGTTAKESSGNGAPEERLREN
GDALSREGSLGPLPGSSAQPHKGQWGTPSCRAPLVSSLMPHILLWPHLTAPPWPSGILKX
XXXXXXXXXXXXXXXXXAADGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences ENSNLEP00000003215 ENSNLEP00000003215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]