SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003449 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003449
Domain Number 1 Region: 427-740
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000668
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003449
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family Integrin beta EGF-like domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003449   Gene: ENSNLEG00000002768   Transcript: ENSNLET00000003620
Sequence length 797
Comment pep:novel supercontig:Nleu1.0:GL397284.1:6965833:7039658:1 gene:ENSNLEG00000002768 transcript:ENSNLET00000003620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCRAWNLRVLVAVVCGLLTGIILALGIWRIVVRIQRGKSSSSSSTPTEFCRNGGTWED
GRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAIRL
CSLSLYGEIELQNVTIGNCNENLETLEKQIKDVTAPLNNISSEVQILTSDANKLTAENIT
SATRVVGQIFNTSRNASPEAKKVAVVTVSQLLDASEDAFERVAATANDDALTTLIEQMET
YSLSLGNQSVVEPNIAIQSANFSSENAVGPSNVRFSVQKGASSSLVSSSTFIHTNVDGLN
PDGQTELQVLLNMTKNYTKTCGFVVYQNDKLFQSKTFTAKSDFSQKIISSKTDENEQDQS
ASVDMVFSPKYNQKEFQLYSYACVYWNLSTKDWDTYGCQKDKSTDGFLRCRCNHTTNFAV
LMTFKKDYQYPQSLDILSNVGCALSITGLALTIIFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNLKASDGDINNIDFDNNDVPRTDTINIPNPMCTAIAALLHYFLLVT
FTWNALSAAQLYFLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGKNPQWE
LDYRQEKICWLAIPEPNGVIKSPLLWSFIIPITIILISNVVIFIIISIKVLWKNNQNLTS
TKKVSSMKKIVSTLSVAVVFGITWILAYLMLVNDDSIRIVFSYVFCLFNTTQGLQIFILY
TVRTKIFQSEASKVLMSLSSIGRRKSLPSVTRPRLRIKMYNFLRSLPTLHERFRLLETSL
SSEEITLSESDKAKESI
Download sequence
Identical sequences G1QR81
ENSNLEP00000003449 XP_003261787.1.23891 ENSNLEP00000003449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]