SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003560 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003560
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.8e-36
Family Cap-Gly domain 0.00083
Further Details:      
 
Domain Number 2 Region: 107-400
Classification Level Classification E-value
Superfamily RNI-like 5.18e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 3 Region: 490-578
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-21
Family Ubiquitin-related 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003560   Gene: ENSNLEG00000002823   Transcript: ENSNLET00000003734
Sequence length 578
Comment pep:novel supercontig:Nleu1.0:GL397308.1:4874131:4955749:1 gene:ENSNLEG00000002823 transcript:ENSNLET00000003734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTLTPNVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFK
CRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPDEDRKEQIVTIGNKPVETIGFDSLM
RQQSQLSKLQEVSLRNCAVSCAGEKGGAAEACPNIRKVDLSKNLLSSWDEVIHIAGQLRH
LEVLNVSENKLKFPSGSVLTGTLSALKILVLNQTGIKWAEAHAQCGGSRHGLDMQKDASK
FVDLCVLQKCSTSNCIISAKDHTSMRMNVAKVLRCAAGCPGLEELYLESDNIFISERPTD
VLQTIKLLDLSSNQLIDENQLYLIAHLPRLEKLILSDIGISSLHFPDAGIGCKTSMFPSL
KYLVVNDNQISQWSFFNELDKLPSLRALSCLRNPLTKENKEAETARLLIIASIGQLETLN
KCEILPEERRRAELDYRKAFGNEWKQAGGHKDPDKNRLSEEFLIAHPRYQLLCLKYGAPE
DWELKTQQPFMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDL
LLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Download sequence
Identical sequences A0A2I3HRZ7
XP_003267330.1.23891 ENSNLEP00000003560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]