SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003686 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003686
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-18
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003686   Gene: ENSNLEG00000003033   Transcript: ENSNLET00000003869
Sequence length 212
Comment pep:novel supercontig:Nleu1.0:GL397394.1:2147138:2158535:-1 gene:ENSNLEG00000003033 transcript:ENSNLET00000003869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKPKSASETSTPEHQGGGLLRSKI
Download sequence
Identical sequences G1QRW8
ENSNLEP00000003686 ENSNLEP00000003686 XP_003276434.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]