SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003899 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003899
Domain Number 1 Region: 416-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 712-777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 772-844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 838-898
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 532-591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000167
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 7 Region: 241-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000366
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 8 Region: 629-706
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000301
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003899   Gene: ENSNLEG00000003213   Transcript: ENSNLET00000004092
Sequence length 995
Comment pep:novel supercontig:Nleu1.0:GL397407.1:1842624:1893362:-1 gene:ENSNLEG00000003213 transcript:ENSNLET00000004092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAALLLLPSLLALLAQGLSLEAPTVGKGQAPGIEETDGELTAAPTPEQPERGVHFVTT
APTLKLLNHHPLLEEFLQEGLEKGDEELRPALPFQPDPPTPFTPSPLPRLANQDSRPVFT
SPTPAMAAVPTQPQSKEGPWSPESESPMLRITAPLPPGPSMAVPTLGPGERASTTPPSRA
WTPTQEGPGDMGRPWVPEVVSQGAGIGIQGTITSSTASGDDEETTTTTTIITTTITTVQT
PGPCSWNFSGPEGSLDSPTDLSSPTDVGLDCFFYISVYPGYGVEIKVQNISLREGETVTV
EGLGGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFP
RRPAYGDVTVTSLHPGGSARFHCATGYQLKGARRLTCLNATQPFWDSKEPVCIAACGGVI
RNATTGRIVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVE
APPVYDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYG
NFSSSAPTYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRGQDTQWMGLP
GKKQAPMWWNSTPEVWGYPVSSPSSGPQAGSALMLLLHRLRIGPGDVLTFYDGDDLTARV
LGQYSGPRSHFKLFTSMADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPN
GWKSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVE
HSRRLISSPKFPVGATVQYICDQGFVLTGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPC
HGLSAPENGAQSPQKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAA
SLDGFYNSRSLDVAKAPAASGTLDAAHIAAAIFLPLVAMVLLVGGVYFYFSRLQGKSSLQ
LPRTRPRPYNRITIESAFDNPTYETGETREYEVSI
Download sequence
Identical sequences ENSNLEP00000003899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]