SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003904 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003904
Domain Number 1 Region: 151-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.62e-58
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily DEATH domain 1.28e-28
Family DEATH domain, DD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003904   Gene: ENSNLEG00000003204   Transcript: ENSNLET00000004097
Sequence length 596
Comment pep:novel supercontig:Nleu1.0:GL397276.1:1763299:1822970:1 gene:ENSNLEG00000003204 transcript:ENSNLET00000004097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLTERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTVGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANITVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKNMQCKKHWKRFLSELEVLLLFRHPNILELAAYFTETEKFCLV
YPYMRNGTLFDRLQCVGDTAPLPWHIRISILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKAESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNMDPSSEAPGHSCRSRPVDSSCSSKFSWDEYKQYKKE
Download sequence
Identical sequences G1QSI6
ENSNLEP00000003904 ENSNLEP00000003904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]