SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005164 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005164
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.12e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.51e-53
Family I/LWEQ domain 0.000000249
Further Details:      
 
Domain Number 3 Region: 2306-2497
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.38e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.11e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 5 Region: 1852-1984
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.76e-46
Family VBS domain 0.000000488
Further Details:      
 
Domain Number 6 Region: 1236-1372
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.51e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 195-307
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-31
Family Second domain of FERM 0.000000637
Further Details:      
 
Domain Number 8 Region: 1086-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-27
Family VBS domain 0.029
Further Details:      
 
Domain Number 9 Region: 308-375
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000509
Family Third domain of FERM 0.0000553
Further Details:      
 
Domain Number 10 Region: 1422-1566
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000706
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000183
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1706-1825
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000314
Family VBS domain 0.024
Further Details:      
 
Domain Number 13 Region: 2020-2143
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000722
Family VBS domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005164
Domain Number - Region: 1609-1669
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00118
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 949-983
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.049
Family I/LWEQ domain 0.0088
Further Details:      
 
Domain Number - Region: 2111-2238
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0497
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005164   Gene: ENSNLEG00000004224   Transcript: ENSNLET00000005427
Sequence length 2552
Comment pep:novel supercontig:Nleu1.0:GL397291.1:22219391:22247212:1 gene:ENSNLEG00000004224 transcript:ENSNLET00000005427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKL
ARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAA
SPKSFTLCFGSLRKGAAAEVSSLSWEQKSHQQAEITGILVGVKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHAIGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQTFPLSKLPSPTPGGKMVAAAKASVP
TIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMESALSVVQNLEKDLQEVKA
AARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLR
SLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVA
KAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGL
NQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGIS
MSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRE
LETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAISTA
SKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQA
QVLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGA
FTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLES
AGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALN
SCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGH
KVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQA
AHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGS
FVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAEN
EEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQ
AGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVED
TKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGSQHSSTQVVLINAVKDVAK
ALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEAT
TEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSR
RAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQL
TGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPR
AKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQW
SQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQD
SEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKERMVGGIAQIIAAQEEML
RKERELEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences ENSNLEP00000005164 ENSNLEP00000005164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]