SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005285 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005285
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 2.55e-57
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 230-477
Classification Level Classification E-value
Superfamily RNI-like 4.24e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.017
Further Details:      
 
Domain Number 3 Region: 547-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.5e-33
Family Rhodopsin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005285   Gene: ENSNLEG00000004321   Transcript: ENSNLET00000005560
Sequence length 907
Comment pep:novel supercontig:Nleu1.0:GL397276.1:7061446:7211552:1 gene:ENSNLEG00000004321 transcript:ENSNLET00000005560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSRLGVLLSLLVLLQLAAGGSSPRSGALLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTETANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPSAFST
LPSLIKLDLSSNLLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDFHKKDAGMFQVQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISAIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCQVIGFLSIFASESSVFLLTLAAL
ERGFSVKCSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSEYGASPLCLPLPFGEP
STTGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILYC
PVAFLSFSSLLNLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLGKQTYF
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSIAYDLPPSSVPSPAYPVTENCHLSS
VAFVPCL
Download sequence
Identical sequences A0A2I3HQ88
XP_003259592.1.23891 ENSNLEP00000005285 ENSNLEP00000005285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]