SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005660 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005660
Domain Number 1 Region: 28-129,180-305,336-456,556-620
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.45e-35
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 
Domain Number 2 Region: 467-523
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000018
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005660   Gene: ENSNLEG00000004608   Transcript: ENSNLET00000005953
Sequence length 730
Comment pep:novel supercontig:Nleu1.0:GL397301.1:12104976:12158609:1 gene:ENSNLEG00000004608 transcript:ENSNLET00000005953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKNLP
RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRYQIKSIPASHCYSIPDLHNAT
DTNKFSCHFTACKTYISGTNCDTGHSVNSPKHCTTFHFKEKLCFKTQKFYNQERKNNGVY
KIPKGKLHYK
Download sequence
Identical sequences G1QXI9
ENSNLEP00000005660 ENSNLEP00000005660 XP_003265626.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]