SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005682 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005682
Domain Number 1 Region: 204-316
Classification Level Classification E-value
Superfamily Immunoglobulin 4.61e-44
Family V set domains (antibody variable domain-like) 0.000002
Further Details:      
 
Domain Number 2 Region: 315-386
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-26
Family C2 set domains 0.0000372
Further Details:      
 
Domain Number 3 Region: 28-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000114
Family V set domains (antibody variable domain-like) 0.00000975
Further Details:      
 
Domain Number 4 Region: 127-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000475
Family C2 set domains 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005682   Gene: ENSNLEG00000004671   Transcript: ENSNLET00000005979
Sequence length 458
Comment pep:novel supercontig:Nleu1.0:GL397358.1:6721323:6746432:1 gene:ENSNLEG00000004671 transcript:ENSNLET00000005979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPGIPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASPKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLSDRADSRKSLWDQRNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLEGPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQDQKKVEFKIDIVVLAFQKASSTVYKKEGEQVEFSFPLAFTVEKLTGSGELCW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMDKKLPLHLTLPQALPQYAGSGNLTLD
LEAKTGKLRQEVNLVVMTATQLRENLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNVKVLPTWPTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
Download sequence
Identical sequences G1QXL1
XP_004092195.1.23891 ENSNLEP00000005682 ENSNLEP00000005682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]