SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005748 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005748
Domain Number 1 Region: 6-118,172-439,538-642
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.19e-35
Family Glycerol-3-phosphate transporter 0.054
Further Details:      
 
Domain Number 2 Region: 457-505
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000018
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005748   Gene: ENSNLEG00000004722   Transcript: ENSNLET00000006047
Sequence length 690
Comment pep:novel supercontig:Nleu1.0:GL397301.1:12474824:12569747:1 gene:ENSNLEG00000004722 transcript:ENSNLET00000006047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSYIAKALGAIVMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNIDSSENSTLTLSTCLINQILSLNRTSPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFTKEGHSSLYLGILHAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTVRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKNQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVIFVLLTLLQVSSYIGGFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSFFTAAMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQ
VFNLFFSALGGTSHVMLIIKLVQPELKSLALGFHSMVIRVLGGILAPIYFGALIDTTCIK
WSTNNCGTRGSCRIYNSTLFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQENDINVSEN
GSVMDEANLESLNNNKHFVPSAGADSETHY
Download sequence
Identical sequences G1QXS7
XP_003265630.1.23891 ENSNLEP00000005748 ENSNLEP00000005748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]