SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006191 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006191
Domain Number 1 Region: 106-424
Classification Level Classification E-value
Superfamily RNI-like 4.63e-61
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006191   Gene: ENSNLEG00000005094   Transcript: ENSNLET00000006507
Sequence length 464
Comment pep:novel supercontig:Nleu1.0:GL397268.1:23416868:23436744:-1 gene:ENSNLEG00000005094 transcript:ENSNLET00000006507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPPRPVGERSMGSPREAARAPARSPAWASTQARTPGAALAVQRESPESGLQEHYSNL
CMEKSQKINPFILHILQKVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILK
NCLYINGLDVGYNLLCDVGAYYAMKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRT
LKYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTRNQAIKAI
NLNRPILYGEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNNSLRYLD
VSCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVS
NNIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCVAYSHLIQTGCLKPDNTDVEPFVV
DGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP
Download sequence
Identical sequences G1QZ20
ENSNLEP00000006191 XP_003256477.1.23891 ENSNLEP00000006191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]