SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006223 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006223
Domain Number 1 Region: 67-245
Classification Level Classification E-value
Superfamily HAD-like 8.84e-61
Family NLI interacting factor-like phosphatase 0.000000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006223   Gene: ENSNLEG00000005131   Transcript: ENSNLET00000006539
Sequence length 250
Comment pep:novel supercontig:Nleu1.0:GL397269.1:26451559:26489925:1 gene:ENSNLEG00000005131 transcript:ENSNLET00000006539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIP
IPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVL
KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK
DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDV
YSMLHRLCNR
Download sequence
Identical sequences ENSGGOP00000003719 ENSGGOP00000003719 ENSNLEP00000006223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]