SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006409 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006409
Domain Number 1 Region: 41-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000124
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006409   Gene: ENSNLEG00000005307   Transcript: ENSNLET00000006735
Sequence length 370
Comment pep:novel supercontig:Nleu1.0:GL397301.1:17476470:17479075:-1 gene:ENSNLEG00000005307 transcript:ENSNLET00000006735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQDRQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPPPPQRSPACPRCCRPLPRRRAPPPR
PSCRTRSPPLGRRTPSTRTAAPTCPSPAPASRGTRRALLRKIPRSRERKLPESLRPEGRR
FKQSEELKHP
Download sequence
Identical sequences ENSNLEP00000006409 XP_012357896.1.23891 ENSNLEP00000006409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]