SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007030 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007030
Domain Number 1 Region: 21-145
Classification Level Classification E-value
Superfamily Lysozyme-like 1.98e-39
Family C-type lysozyme 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007030   Gene: ENSNLEG00000005806   Transcript: ENSNLET00000007379
Sequence length 146
Comment pep:novel supercontig:Nleu1.0:GL397269.1:30901207:30914975:-1 gene:ENSNLEG00000005806 transcript:ENSNLET00000007379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTRDGYTGFGLFQIRGSVWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
Download sequence
Identical sequences G1R1F8
ENSNLEP00000007030 XP_003256958.1.23891 XP_012367199.1.23891 ENSNLEP00000007030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]