SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007313 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007313
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 66-115
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-18
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000153
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007313   Gene: ENSNLEG00000006043   Transcript: ENSNLET00000007674
Sequence length 530
Comment pep:novel supercontig:Nleu1.0:GL397326.1:4450014:4464848:1 gene:ENSNLEG00000006043 transcript:ENSNLET00000007674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLHVGQDGLELPTSGDLPASASQSAGITGVSHRTQPPSFQRLTSKDVRKEETQKRKRK
AKESGMALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMM
NMFSSTGQGNTEVIHTGTLQRHASHHTGDTCFQEIEKDIHDFVFQWQENETNGHEAPMTE
IKKLTSSTERYDQGHAGNKPIKDELGSSFYSHLPELHIFHPEGKIGSQVGKAIKDAFSVS
GSQRISCRPKTRISNKYGNNFLQSSLLTQKWEVHTREKSFQRNESGKAFNCSSLLKKHQI
IHLGDKRYKCDVCGKIFHQKRYLACHRCHIGEKPYKCNECGKTFGHNSALLVHKAIHTGE
KPYKCNECGKVFNQQSNLARHHRLHTGEKPYKCEECGKVFSRKSHVERHRRIHTGEKPYK
CKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECDKTFVQNSSLVMHKVIHTGEKRYKCNEC
GKVFNHKSNLACHHRLHTGEKPYKCNDCGKVFNRKSNLERHHRLHTGKKS
Download sequence
Identical sequences ENSNLEP00000007313 ENSNLEP00000007313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]