SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007624 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007624
Domain Number 1 Region: 626-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-78
Family Protein kinases, catalytic subunit 0.000000000391
Further Details:      
 
Domain Number 2 Region: 39-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-72
Family Ephrin receptor ligand binding domain 0.000000224
Further Details:      
 
Domain Number 3 Region: 338-543
Classification Level Classification E-value
Superfamily Fibronectin type III 6.87e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 921-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007624
Domain Number - Region: 266-342,377-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000286
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007624   Gene: ENSNLEG00000006254   Transcript: ENSNLET00000007993
Sequence length 997
Comment pep:novel supercontig:Nleu1.0:GL397268.1:38600833:38620423:1 gene:ENSNLEG00000006254 transcript:ENSNLET00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARPPPPPSPPPGLLPLLPPLLLLLPLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences ENSNLEP00000007624 ENSNLEP00000007624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]