SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007646 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007646
Domain Number 1 Region: 43-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000281
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007646   Gene: ENSNLEG00000006293   Transcript: ENSNLET00000008015
Sequence length 203
Comment pep:novel supercontig:Nleu1.0:GL397262.1:1631382:1673862:1 gene:ENSNLEG00000006293 transcript:ENSNLET00000008015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPLAVALGTLHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEM
ACSFRGSGSPSYSLEIQWYVXXXXXXXXXXPPRSQQLKASQQEDAGKEATKISVVKVVGS
NISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAP
APPPPKPGKELRKRSVDQEACSL
Download sequence
Identical sequences ENSNLEP00000007646 ENSNLEP00000007646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]