SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008128 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008128
Domain Number 1 Region: 73-120
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000034
Family Elafin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 29-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000017
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008128   Gene: ENSNLEG00000006681   Transcript: ENSNLET00000008515
Sequence length 221
Comment pep:novel supercontig:Nleu1.0:GL397262.1:8926621:8931776:-1 gene:ENSNLEG00000006681 transcript:ENSNLET00000008515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQSLLLLGTLLAVGSQLPAVFGRKKGGKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRK
CCYRACFRQCVPRVSVKLGSCPKDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDP
ARGMAPGCPGQANSDLGSVALNLSWGPAERVHDGRPGALPAGQHYLYQWWFQPSDKHWPS
LQPIHPWFLLLGVKVHSLSSEEALCINPVPCTTAIRASHPS
Download sequence
Identical sequences ENSNLEP00000008128 ENSNLEP00000008128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]