SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008133 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008133
Domain Number 1 Region: 28-74
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000249
Family Elafin-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008133   Gene: ENSNLEG00000006683   Transcript: ENSNLET00000008521
Sequence length 111
Comment pep:novel supercontig:Nleu1.0:GL397262.1:8940060:8941100:-1 gene:ENSNLEG00000006683 transcript:ENSNLET00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSSFLVLMVSLALVTLVAVEGVKEGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGERK
CCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKSPGSSSTRCPQK
Download sequence
Identical sequences G1R4L1
XP_003253670.1.23891 ENSNLEP00000008133 ENSNLEP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]