SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008223 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008223
Domain Number 1 Region: 47-78
Classification Level Classification E-value
Superfamily Elafin-like 0.0000615
Family Elafin-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008223   Gene: ENSNLEG00000006753   Transcript: ENSNLET00000008611
Sequence length 81
Comment pep:novel supercontig:Nleu1.0:GL397262.1:9433521:9434970:1 gene:ENSNLEG00000006753 transcript:ENSNLET00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQTLLPVLVLCVVLLLLQAQGGYHDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHR
DCQANNICCSTYCGNVCMSIL
Download sequence
Identical sequences G1R4V1
ENSNLEP00000008223 XP_003253695.3.23891 ENSNLEP00000008223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]