SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008229 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000008229
Domain Number - Region: 51-86
Classification Level Classification E-value
Superfamily Elafin-like 0.00157
Family Elafin-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008229   Gene: ENSNLEG00000006759   Transcript: ENSNLET00000008618
Sequence length 89
Comment pep:novel supercontig:Nleu1.0:GL397262.1:9488449:9510695:-1 gene:ENSNLEG00000006759 transcript:ENSNLET00000008618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSCERRASKSVGQILLWDFGYTCTLSHRRRNSTEILSRSLPALYTGIKVCEKRPSIDLC
IHHCSYFQKCEANNICCSAFCGNVCMSIL
Download sequence
Identical sequences G1R4V7
ENSNLEP00000008229 ENSNLEP00000008229 XP_012367201.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]