SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008729 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008729
Domain Number 1 Region: 248-335,541-578
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.49e-45
Family Inhibitor of apoptosis (IAP) repeat 0.00000524
Further Details:      
 
Domain Number 2 Region: 160-251
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.5e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000847
Further Details:      
 
Domain Number 3 Region: 21-113
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.94e-31
Family Inhibitor of apoptosis (IAP) repeat 0.00031
Further Details:      
 
Domain Number 4 Region: 440-536
Classification Level Classification E-value
Superfamily DEATH domain 1.84e-21
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008729   Gene: ENSNLEG00000007165   Transcript: ENSNLET00000009146
Sequence length 603
Comment pep:novel supercontig:Nleu1.0:GL397262.1:35433144:35453399:1 gene:ENSNLEG00000007165 transcript:ENSNLET00000009146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPIEKHKKLYPSCRFVQSLNSVNNLEATSQPFPSSVTNST
HSVFPGTENSGYFSGSYSSFPSNPVNSRANQDFSALMRSSYNCAMNNENARLLTFQMWPL
TFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQD
TSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSI
IRFEPGEDHSEDAIMMDTPVVNAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDLL
NAEDEIREEERERATEEKESNDLLLIRKNRKALFQHLTCVIPILDSLLTARIINEQEHDV
IKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEADAVLYEHLFVQQDIKYIPTEDVSD
LPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRT
FLS
Download sequence
Identical sequences G1R6A7
ENSNLEP00000008729 XP_012351361.1.23891 ENSNLEP00000008729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]