SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008730 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008730
Domain Number 1 Region: 263-350,556-593
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000198
Further Details:      
 
Domain Number 2 Region: 176-251
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.24e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 39-137
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 9.55e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 455-551
Classification Level Classification E-value
Superfamily DEATH domain 8.95e-22
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008730   Gene: ENSNLEG00000007166   Transcript: ENSNLET00000009147
Sequence length 618
Comment pep:novel supercontig:Nleu1.0:GL397262.1:35463281:35489149:1 gene:ENSNLEG00000007166 transcript:ENSNLET00000009147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCCFIQNLVSAS
LGSTSKNTSPVRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDFSPSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GEDYKTVNDIVSALLNAEDEKREEETENELKKCRQDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Download sequence
Identical sequences ENSNLEP00000008730 ENSNLEP00000008730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]