SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008956 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008956
Domain Number 1 Region: 59-395
Classification Level Classification E-value
Superfamily Subtilisin-like 7.86e-88
Family Subtilases 0.0000000252
Further Details:      
 
Domain Number 2 Region: 390-535
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.93e-36
Family Proprotein convertase P-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008956   Gene: ENSNLEG00000007340   Transcript: ENSNLET00000009377
Sequence length 701
Comment pep:novel supercontig:Nleu1.0:GL397262.1:50742679:51112123:-1 gene:ENSNLEG00000007340 transcript:ENSNLET00000009377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAWRAGELEGHAELSQQAGHRPSPLPACLRQXXEAVLAGHEAVRWHSEQRLLRRAKRSIH
FNDPKYPQQWHLNNRQSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQNIAPNYSPE
GSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGP
LTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFV
VASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTFSGGDKMLRS
IVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATRYED
RRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPVLKENKAIPQSPR
SLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPRSMDS
DPNGFDDWTFSTVRCWGERARGTYRLVVRDVGDESFQVGILRQWQLTLYGSVWSPVDIRD
RQRLLESAMSGKYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVYYML
EVYLSQRNVASNQVCRSGPCHWPHRSRKAKEEGTELESVPLCSSKDPDEVETENRGPPTT
SDLLAPDLLEQRDWSLSQNKSALDCPHQHLDLLHGKEEQIC
Download sequence
Identical sequences ENSNLEP00000008956 ENSNLEP00000008956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]