SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009159 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009159
Domain Number 1 Region: 377-500
Classification Level Classification E-value
Superfamily EF-hand 1.02e-47
Family EF-hand modules in multidomain proteins 0.0000092
Further Details:      
 
Domain Number 2 Region: 503-597
Classification Level Classification E-value
Superfamily EF-hand 1.45e-34
Family EF-hand modules in multidomain proteins 0.0000392
Further Details:      
 
Domain Number 3 Region: 579-665
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 215-336
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 339-376
Classification Level Classification E-value
Superfamily WW domain 0.0000000000114
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 74-171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009159   Gene: ENSNLEG00000007531   Transcript: ENSNLET00000009599
Sequence length 952
Comment pep:novel supercontig:Nleu1.0:GL397395.1:2558287:2592221:1 gene:ENSNLEG00000007531 transcript:ENSNLET00000009599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRKDLWRKSGHRICVSLGKLL
SPVGASGPLEPLAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQKDEEL
SAQLPLQGDVALVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEEPHSES
KDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAMEELST
TLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPMKDGVKLVNDLAHQLAISDVH
LSMENSQALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFLSSSVQVPWERAISPN
KVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDLVTLTT
ALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLLNVFDS
GRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQVPRQL
GEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTIAEQVK
HQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPTTSSEN
MRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMLPHADTHSRIEHFA
SRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDRESAFGQQAPCSVATESKGEL
QKILAHLEDENRILQGELRRLKWQHEEAAEAPSLADGSTEAAPDHRNEELLAEARILRQH
KSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEGSHPRE
KGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences ENSNLEP00000009159 ENSNLEP00000009159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]