SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009270 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009270
Domain Number 1 Region: 361-642
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-46
Family Kelch motif 0.0043
Further Details:      
 
Domain Number 2 Region: 782-928
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-23
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 127-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 1062-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009270
Domain Number - Region: 98-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 246-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009270   Gene: ENSNLEG00000007613   Transcript: ENSNLET00000009713
Sequence length 1428
Comment pep:novel supercontig:Nleu1.0:GL397425.1:573619:801307:1 gene:ENSNLEG00000007613 transcript:ENSNLET00000009713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAAAATEARLRRRTAATAALAGRSGGPHRDWDVTRAGRPGLGAGLRLPRLLSPPLRPR
LLLLLLLSQPLLLLQLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCP
AGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATEC
SWDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGF
NITYSFDMCPNNCSGRGECKISNSSNTVECECSENWKGEACDIPHCTDNCGFPRRGICNS
SDVRGCSCFSDWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMF
NHSDYNMVLAYDLASREWLPLNHSVNSVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNEL
RVFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEYD
LDKNTWSILHTQGALVQGGYGHSSVYDDRTGALYIHGGYKAFSANKYRLADDLYRYDVDT
QMWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWS
VLPRPDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDAHRSEAACLAAG
AGIRCVWDTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCH
WCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECI
ALPENICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLRI
MQSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPST
RGLKAATCINPLNGSVCERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVDS
NAYVASFPFGQCMEWYTMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSY
KGPVKMPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCE
NLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCE
VENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASK
NFNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFT
WPIKIQIAFSQHSNFMDLVQFFVTFFSCFPLFARVAAVVWKIKTKLWASRRREQLLREMQ
QMASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGG
IPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSNLEP00000009270 ENSNLEP00000009270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]