SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009918 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009918
Domain Number 1 Region: 170-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 59-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000384
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009918   Gene: ENSNLEG00000008138   Transcript: ENSNLET00000010402
Sequence length 269
Comment pep:novel supercontig:Nleu1.0:GL397339.1:2803604:2816088:1 gene:ENSNLEG00000008138 transcript:ENSNLET00000010402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACLLQLPQRLLLLGAAALTATALETADLADLCGQTWQGDGLLLRSHAASRRFYFVAPD
TDCGLWVQAAAPGDRILFQFRFFLVYLTPAPPALNTSSPAPADPCAPGSYLQFYEGPPGA
PPLGSPLCGLTIPVPVASSGPLLGLRLVTRGRQPCVDFVGEVTSFRLGPCGAYFRCQNGR
CIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRPLTPSPALGSA
GSLRIAAERSPPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences ENSNLEP00000009918 ENSNLEP00000009918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]